PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_6157_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 468aa    MW: 50396.7 Da    PI: 5.1346
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_6157_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-163279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++v+++G g+W+++ r  g+ R++k+c++rw ++l
    Neem_6157_f_2 32 KGPWTAAEDAILTEYVRKHGEGNWNAVQRNTGLARCGKSCRLRWANHL 79
                     79******************************************9986 PP

2Myb_DNA-binding24.94.8e-0885114131
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartm 31 
                      +g++++eE+ l+v++++qlG++ W++ a+ +
    Neem_6157_f_2  85 KGAFSPEEERLIVELHAQLGNK-WARMAAQV 114
                      799*******************.***99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.52783IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-222982IPR009057Homeodomain-like
SMARTSM007171.7E-133181IPR001005SANT/Myb domain
PfamPF002491.9E-143279IPR001005SANT/Myb domain
SuperFamilySSF466893.63E-2433109IPR009057Homeodomain-like
CDDcd001673.31E-113479No hitNo description
PROSITE profilePS500906.24980114IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.4E-1283114IPR009057Homeodomain-like
SMARTSM007171.484125IPR001005SANT/Myb domain
PfamPF002492.0E-685114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MLLGNSSSEQ LESGSSGLNG EGGGDGGIQL KKGPWTAAED AILTEYVRKH GEGNWNAVQR  60
NTGLARCGKS CRLRWANHLR PNLKKGAFSP EEERLIVELH AQLGNKWARM AAQVSLIYII  120
LIFIPTAPLS PTPPPLSPNL QSPHHPSYPT LSLFDTNNNN SNNSNVSNPF NIPRTPPTLQ  180
NPPRFKRFHS DTSIPNIGTA TTANNVSNSN NGIGSSTFQS GSNFSLPFSP FLRSPSSSSL  240
LNAPQSNCNT SAYSNTASRL LSLPSFSTLP VSFNTPNSSS FFRTTDEKDC ILSNSSVFAL  300
KPELPSSQLL SQSGNAELNF DNEKLSVSCS GSGLLEDLLE EAQALACNFG ESSGRASEEK  360
REFSGFNQWN DSISINLSSG LKPKEEAGGQ MNSTHEDLSK LLNVIPSMEV PEWYNDSGEV  420
SNGQSSVVTD ENIGLEMQQI ASLFRVDSNT EHARPPGSCS LDNLPGIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-202911124105MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006475135.11e-114PREDICTED: myb-like protein A
TrEMBLV4USX82e-63V4USX8_9R
TrEMBLA0A067F9F73e-63A0A067F9F7_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.27e-48myb domain protein 101